Establishing secure connection… Loading editor… Preparing document…
Navigation

Fill and Sign the Sample Filled Up Bir Form Ot

Fill and Sign the Sample Filled Up Bir Form Ot

How it works

Open the document and fill out all its fields.
Apply your legally-binding eSignature.
Save and invite other recipients to sign it.

Rate template

4.5
49 votes
Vol. 266, No. 22, Issue of August 5, PP. 14646-14653,1991 Printed in U.S.A. THEJOURNAL OF BIOLOGICAL CHEMISTRY (0 1991 by The American Society for Biochemistry and Molecular’ Biology, Inc Nucleotide Sequence, TranscriptionalAnalysis, and Expression of Genes Encodedwithin the Form I COa Fixation Operon of Rhodobacter sphaeroides” (Received for publication, February 1, 1990) Janet L. Gibson$, Deane L. Falcone$, and F. Robert Tabita$§ From the $Departmentof Microbiology and The Biotechnology Center, The Ohio State Uniuersity, Columbus, Ohio 43210 In Rhodobacter sphaeroides, many of the structural genes encoding enzymes of the Calvin cycle areduplicated and groupedwithin twoseparate clusters. In this study, the nucleotide sequence of a 5627-base pair region of DNA that contains the form I Calvin cycle gene cluster has been determined. The five open reading frames are arranged in the order, fbpA prkA cfxA rbcL rbcS and are tightly linked and oriented in the same direction. The results of insertional mutagenesis studies suggest the genes are organized within an operon. Consistent with this proposal, the cfxA gene has been tentatively identified as a gene encoding the Calvin cycleenzyme, aldolase. Measurement of the activities of various Calvin cycle enzymes in the insertion mutants showed that inactivation of genes within one COa fixation cluster affected expression of genes within the second cluster, revealing a complex regulatory network. COz is limiting, whereastheform I1 Rbu-P2 carboxylase predominatesunderconditions where carbon is saturating and electrons are in excess (Jouanneau and Tabita, 1986; Falcone et al., 1988; Hallenbeck et al., 1990a,1990b). The functional andregulatory differences suggest diverse roles for the two enzymes in uiuo. However, the inactivation of either R. sphaeroides does not preclude Rbu-P2 carboxylasein growth underanyconditiontested(Falcone et al., 1988). Therefore, the requirementof one form or the other does not appear to be absolute. The form I and form I1 Rbu-P2 carboxylasecoding sequences in R. sphaeroides have been localized to physically distinct loci and are clustered with structuralgenes encoding other Calvin cycle enzymes (Gibson and Tabita, 1987, 1988; Gibson et al., 1990; Hallenbeck and Kaplan, 1987). Some of these genes are present in both clusters, such as the genes coding forfructose 1,6-bisphosphatase(fbpA, fbpB), phosphoribulokinase ( p r M , p r k B ) ,and genes encoding a protein of unknown function, termed cfxA and cfxB. However, coding sequences for transketolase (tklB) and glyceraldehyde-3In purple non-sulfur photosynthetic bacteria,CO, fixation phosphate dehydrogenase ( g a p B ) are solely present within via the Calvin cycle has multiple functions. In addition to its the form I1 or B cluster (Gibson and Tabita,1988; Gibson, et role in providing carbon for cells during photo- or chemoli- al., 1990). The duplication and clustering of genes encoding thoautotrophic growth, C02 can alsoserve asanelectron Calvin cycle enzymes in R. sphaeroides raise intriguing quesacceptor to maintain redox balance in cells growing on re- tions concerning their regulation and expression. In attempts duced carbon sources such as malic or butyric acid. In some to further elucidate the molecular mechanisms underlying the photosyntheticbacteria, a complex system has evolved to control of the two gene clusters we have analyzed the primary accommodate the different modes of CO, fixation. For one, sequence of these two regions. In the present investigation we Rhodobacter sphaeroides synthesizes discrete forms of ribulose have determined the nucleotidesequence and the deduced 1,5-bisphosphate carboxylase/oxygenase (Rbu-P2 carboxyl- primary structure of all the structural genes of the form I ase),’ the enzyme that catalyzes the primary COz fixation Calvin cycle gene cluster;insertionalmutagenesisstudies reaction (Gibson and Tabita, 1977). The structural and cata- indicate that thegenes belongto a single transcriptional unit. lytic properties of the formI and form I1 Rbu-Pz carboxylases In addition, on the basis of DNA sequence comparisons, we differ substantially and they exhibit distinct inductive reconclude that cfxA encodes aldolase, a n additional structural sponses under varyinggrowth conditions (Gibson and Tabita, gene of the Calvin cycle. 1977; Jouanneau and Tabita,1986). It is known that the form I Rbu-Pz carboxylase predominates under conditions where EXPERIMENTALPROCEDURES Bacterial Strains, Plasmids, and Growth Conditions-Escherichia * This work was supported by National Institutes of Health Grant GM 24497 and United States Departmentof Agriculture Grants 89- coli strain JM107 was used as the host strain for all pUC-derived 37262-4566 and 87-CRCR-1-2591. The costs of publication of this plasmid constructs (Yanisch-Perron et al., 1985), and E. coli SMlO of pSUP202 constructs article were defrayed in part by the payment of page charges. This (Simon et al.., 1983) was used for delivery article must therefore be hereby marked “aduertisement” in accord- into R. sphaeroides. E . coli strains were routinely grown in LB broth a t 37 “C.R. sphaeroides H R was grown aerobically in a peptone-yeast ance with 18 U.S.C. Section 1734 solely to indicate this fact. 1983), photoheterotrophT h e nucleotide sequence(s) reportedin thispaper has been submitted extract medium (PYE) (Weaver and Tabita, ically on 0.4% malate or photolithoautotrophically in an atmosphere totheGenBankTM/EMBLDataBankwith accessionnumber(s) of1.5%CO,, 98.5% Hz,as describedpreviously (Jouanneauand M64624. were added to growth mediaat the following To whom correspondence should be addressed: Dept. of Micro- Tabita, 1986). Antibiotics biology, The Ohio State University, 484 West 12th Ave., Columbus, concentrations (pg/ml): for E . coli, ampicillin, 50; tetracycline, 25; trimethoprim, 200; kanamycin 25; for R. sphueroides, streptomycin, OH 43210. ’ The abbreviations usedare: Rbu-P2 carboxylase,ribulose bis- 25; tetracycline, 12.5; trimethoprim, 200; kanamycin, 25. DNA Sequencing-DNA sequencing was performedon double phosphate carboxylase/oxygenase; FBPase, fructose 1,6-bisphosphastranded DNA templates by the dideoxy chain termination method tase; PRK, phosphoribulokinase; SDS, sodium dodecyl sulfate; kb, of Sanger et al. (1977) using the Sequenase kit obtained from U. S. kilobase pair; ORF, open reading frame. 14646 Sequence of Calvin Cycle Genes of R. sphaeroides Biochemicals and [LY-~'S]~ATP from Du Pont-New EnglandNuclear. In some cases G C compressions were resolved by replacing dGTP with dITP or deaza-GTP inthe sequencing reactions. Defined restriction fragments cloned into pUC vectors were sequenced using commercial primers from United States Biochemical Corp. Additional oligonucleotide primers were obtained from Operon Technologies, Inc., Alameda, CA. DNA sequences were determined completely on both strands of DNA within the coding regions. The 5' end of the sequence up to nucleotide 190 and the 3' end of the sequence beyond nucleotide 5355 weredetermined on only one strand. Enzyme Assays-Cell extracts for enzyme assays were prepared as described previously (Jouanneau andTabita, 1986). The Rbu-Pz carboxylase assay was based on the incorporation of 14C02 intoacidstable radioactivity (Gibson and Tabita, 1977). Phosphoribulokinase (PRK) activity was measured using an assay coupled to the activity of added Rbu-P2 carboxylase as described by Tabita (1980). Fructose 1,6-bisphosphatase (FBPase) activity was determined as described previously (Gibson and Tabita, 1988). Total protein measurements were made according to a modified Lowry protocol described by Markwell et al.. (1978). Amino-terminal AminoAcidAnalysis-The amino-terminalsequence of the form I Rbu-P2 carboxylase large and small subunits was determined as described previously (Tabita et al., 1986) on purified subunits (Gibson and Tabita, 1985). Insertional Mutagenesis-To inactivate fbpA, a 2.7-kb SalI trimethoprim resistance cartridge, derived from pUC1889 (Falcone and Tabita, 1991) from which an internal EcoRI site was deleted, was cloned into the SalI site of pJG1244 (Gibson and Tabita, 1988). The disruptedfbpA gene was movedas a PstI fragment intothe mobilizable vector pSUP202, and conjugated into R. sphaeroides using the diparental mating procedure (Simon et al.. 1983). For mutagenesis of c f d , the 3.4-kb EcoRI fragment of pJG6 (Gibson and Tabita,1987) which carries p r M , c f d , and part of rbcL was recloned into pUC1318 (Kay and McPherson, 1987) to eliminate the vector PstI site. The resulting construct, pJG136, was digested with PstI and religated to remove a 581-base pair PstI fragment within the c f d open reading frame (ORF), generating the deletion derivative, pJG1361. A trimethoprimresistance cartridge was inserted into the unique PstI site of pJG1361. The 5.5-kb EcoRI fragment containing the deletion-insertion mutationwas cloned into pSUP202 (Simon et al., 1983) and the resulting construct, pSUP1361, was mated into R. sphaeroides as described above. Streptomycin was used to select against the E. coli donor strains. Trimethoprim-resistant exconjugants were treated for tetracycline sensitivity, indicative of loss of vector sequences. Immunological Methods-Rocket immunoelectrophoresis was performed according to the protocol described previously (Jouanneau and Tabita, 1986). The use of antibodies directed against the form I and form I1 Rbu-Pncarboxylase of R. sphaeroides allowed quantitation of each protein in crude extracts by comparison to standards of purified Rbu-P2carboxylase. Western immunoblot analsyis was performed as described previously using antibodies directed against recombinant form I PRK (Gibson and Tabita, 1987). RNA Isolation and Northern Blot Analyses-RNAwas isolated from A. sphueroides according to theprocedure described by Zhu and Kaplan (1985). For Northern analysis, RNA was electrophoresed in formaldehyde-agarose gels, electroblotted to Genescreen Plus (Du Pont-New England Nuclear Corp.), and hybridized in 50% formamide a t 42 "C as described in protocols supplied with the Genescreen Plus membranes. The restriction fragments used as gene probes in Northern blot analysis of the form I clustersare indicated in Fig. 1. Additional probes included a 0.9-kb PstI fragment of pRQ53 (Quivey and Tabita, 1984) for rbpL and a 0.3-kb SmaI-Sal1 fragment of pJG5410 (Gibson and Tabita, 1988) for gapB. + RESULTS Organization and Sequence Analysis of the Form I Gene Cluster-Five genes within the form I Calvin cyclegene cluster were previously identified by Southern hybridization analyses and shown to be arranged in the order: fbpA prkA c f d rbcL rbcS (Gibson and Tabita, 1988). Expression studies in E. coli demonstrated that thegenes were transcribed in the same direction (Gibson and Tabita, 1986, 1987, 1988). In this study, the complete nucleotide sequence of the 5.5-kb gene cluster has been determined. A physical map of the form I 14647 cluster is shown in Fig. 1 along with relevant restriction sites and the sequencing strategy employed in thisstudy. The complete nucleotide sequence and deduced amino acid sequences are shown in Fig. 2. The assignment of the four open reading frames corresponding to fbpA, prkA, rbcL, and rbcS was based on computer alignment with published sequences from other organisms and on appropriately positioned ribosome-binding sites and initiation codons. In thecase of prkA, rbcL, and rbcS, amino-terminal sequence data of purified proteins were available, thus making assignment of coding regions unequivocal (Fig. 3). The first gene in the cluster, fbpA, codes for the form I FBPase. Although the overall fbpA coding region was easily aligned with other FBPase sequences, the assignment of the putative start codon was difficult as the amino terminus of FBPase is not highly conserved with regard to either length or sequence. Examination of the amino-terminal region of the fbpA sequence revealed two possible start sites including one in-frame GTG codon at position 319 and an ATG codon at position 373. The GTG codon is separated from a consensus ribosome binding sequence by the usual distance observed in E. coli, whereas the ATG codon is separated from a potential ribosome-binding site by only four nucleotides. Initiation at position 319 wouldproduce a translation product of approximately the same length as thatproposed for the R. sphaeroides fbpB gene product (Gibson et al., 1990). If the fbpA translational start site is assigned to the codon GTG at position 319, then theform I FBPase protein is 1002 nucleotides long, ending in a TGA codon at position 1320 (Fig. 2). The deduced amino acid sequence reveals a polypeptide of 333 amino acids with a calculated molecular weight of 35,962. The deduced amino acid sequence derived from the fbpA gene has recently been compared to the R. sphaeroides fbpB gene product as well as to other FBPase sequences and therefore will not be discussed here (Gibson et al., 1990). The second gene in the cluster, prkA, starts at an ATG codon six nucleotides downstream from the stop codon of fbpA. As noted previously, protein sequence data of the amino terminus were available for the form I PRK (Hallenbeck and Kaplan, 1987) and the known amino terminus aligns exactly with that deduced from the nucleotide sequence (Fig. 3). The putative ribosome-binding site GGAG, actually lies within the fbpA coding sequence. This feature was also observed in the fbpB prkB sequence where the intergenic region was only 3 nucleotides long (Gibson et al., 1990). The prkA gene is 873 nucleotides long and ends in a TGA codon. The translation product is a polypeptide of 290 amino acids with a predicted u k ib FIG. 1. Physical and genetic map of the form I CO, fixation gene cluster and probes used i n Northern blot analysis. The restriction map of the region of DNA containing the form I operon is shown. Various restriction fragments were cloned into pUC vectors and sequenced using the commercially available universal and reverse The dark bars under the map primers (+) or custom primers (e). indicate the restriction fragments used as probes in Northern blot hybridizations. Gene designations are shown above corresponding open reading frames. Restriction enzymes are: X, XhoI; S, SalI; E, EcoRI; Bg, BglII; B , BamHI; Sm, SnaI; P, PstI. Sequence of Calvin Cycle Genes of R. sphaeroides 1 2 3 1 5 6 7 8 14649 R . sphaemides Forn I LSU a) Met Asp Thr Lys Thr --- Glu Ile b ) Met Asp Thr Lys ThrThr Glu Ile 8. s t e l m t h e m p h i l u s E . coli 1 2 3 1 5 6 7 8 Forn I SSU a) Met Arg Ile Thr Gln Gly --- Phe b ) Met Arg Ile Thr GlnGly Cys Phe 1 2 9 4 5 6 7 veart 8 .* ..* *. ............ MSKIFDWXPGV **** t t A B .... A B *g i 38 50 88 YDY TGK LPWI 175 200 .. B A 134 150 * * * I * A .* 225 250 B *.* t A 275 300 B * t t t * * A 320 350 B B Am Yeast R . sph,cmidcr 8. rteamthcmphilur E . coli ASP Ser veart ASP FIG.5. Amino-terminal alignment of the R. sphaeroides cfxA deduced amino acid sequence with class I1 FBP aldolase gene products from various sources. Similar amino acid residues, as defined in Fig. 4, are shaded. Identity between all gene products is indicated (0)as is identity between the cfrA and B. stearotherrnophilus fba sequences (0).Sequences were aligned to maximize homology between all four sequences. 100 **** A HIS E . coli FIG.3. Amino-terminal amino acid analyses and deduced amino acid sequences of form I Rbu-Pz carboxylase and PRK. Amino acid sequence of form I Rbu-Pz carboxylase large (LSU) and small ( S S U ) subunits and form I PRK determined by Edman degradation ( a ) or deduced from the DNA sequence ( b ) .Amino acids are numbered from the amino-terminal methionine. The amino-terminal sequence data for form I PRK were taken from Hallenbeck and Kaplan (1987). t. * B Glu ASP V I 1 8 . ItearothemphilUS Forn I PRK a) Ser Lys Lys --- Pro Ile Ile b ) Met Ser Lys Lys H I S Pro Ile Ile A GIY v11 61" Gln Ile Leu Lyr Arp Lyr Thr Gly Val I l r GlY Val GNASKITVIPHDDMAKRYASGALDPAVATAKAA 359 DVL 359 .............................. FIG.4. Sequence alignment of the R. sphaeroides cfxA and E. coli fba gene products. Deduced amino acid sequences of c f d ( A ) and E. coli fba ( B ) were aligned by BESTFIT parameters. Residues that are in the same group (ILVM, YFW, HKR, QNED, PAGST) are shaded. Identical residues are indicated by an asterisk. uitro transcription-translation system from a DNA fragment containingpru and cfxA (Hallenbeck and Kaplan, 1987). A search of the available sequence in theNBRF data base using BESTFIT parameters revealed a strong similarity between cfxA and the class I1 aldolase (fba) from E. coli (Alefounder e t al., 1989). The computer alignment of the two sequences is shown (Fig. 4). Although the fba gene was isolated from E. coli on the basis of its role in glycolysis, it is interesting that aldolase also functions within the Calvin cycle. In addition, the E. coli fba gene was isolated in a glycolytic gene cluster with genes encoding glyceraldehyde-3-phosphate dehydrogenase and 3-phosphoglycerate kinase (Alefounder and Perham, 1989). The linkage of cfxB, the cfxA homolog in the form I1 Calvin cycle cluster in R. sphaeroides, to gapB strengthens the possibility that the cfx genes encode aldolase. The similarity extends over the entire length of the polypeptides with only three small gaps needed to maximize the homology. The E. coli aldolase and R. sphaeroides cfxA deduced sequences are 17% identical and 41% identical-similar when conservative amino acid substitutions are considered. Unfortunately, very little sequence information is available for class I1 aldolases, but in addition to theentire sequence of the fba gene from E. coli, amino-terminal sequences were published for the FBPase aldolase from Saccharomyces cereuisiae and Bacillus stearotherrnophilus (Alefounder et al., 1989). These sequences are aligned with the deduced amino acid sequence of cfxA (Fig. 5). As noted previously, the yeast and E. coli class I1 aldolase share considerable sequence similarity (Alefounder et al., 1989). Almost 50% of the first 40 amino acid residues of the two proteins are identical and 62% similar when conservative amino acid substitutions are applied. Much less similarity is observed between the E. coli and Bacillus enzymes. Only 36% identity and 52% similarity is observed within the first 25 amino acid residues. However, alignment of the putative coding sequence of cfxA with the Bacillus sequence revealed substantial sequence homology (Fig. 5). Within the first 25 amino acid residues, 40% are identical and 80% similar suggesting the remainder of the sequence might share more homology than that observed between the E. coli fba gene product and c f w l . Attempts to assay FBP aldolase in extracts of E. coli transformed with plasmids containing cfwl under control of the lac promoter have been unsuccessful thus far, perhaps indicating special requirements or processing of the putative R. sphaeroides aldolase in an E. coli background. The last two genes that have been identified within the form I gene cluster, rbcL and rbcS, encode the large and small subunits, respectively, of the form I Rbu-P2carboxylase. The rbcL coding sequence that begins just downstream of cfxA (Fig. 2) was aligned on the basis of amino-terminal sequence data (Fig. 3). The intergenic region between cfxA and rbcL is only 13 base pairs long and contains the rbcL putative ribosome-binding site, GGAG (Fig. 2). The rbcL gene is 1461 nucleotides long and ends at a TAA codon. As for rbcL, the assignment of the rbcS ORF was based on amino-terminal analysis of the purified protein. The rbcS gene begins at an ATG codon 11 base pairs downstream from rbcL. The intergenic region between rbcL and rbcS contains a possible ribosome-binding site. The gene encoding the Rbu-P2carboxylase small subunit is 390 nucleotides long and ends at a TGA codon. The polypeptides encoded by rbcL and rbcS are 486 and 129 amino acids in length, respectively. The predicted molecular weights of 53,681 for the large subunit and 15,163 for the small subunit are consistent with the previously determined molecular weights of the proteins based on SDS-gel electrophoresis (Gibson and Tabita, 1977). The R. sphaeroides Rbu-P2 carboxylase large and small subunit amino acid sequences exhibit striking homology to the sequences determined for the Alcaligenes eutrophus and Xanthobacterflauus Rbu-P2carboxylase subunits (Fig. 6). The large subunits share 85% and the small subunits approximately 60% identity. In contrastto thehigh degree of homology observed between the sequences of the other bacterial typeIRbu-P2 carboxylases, the deduced large and small subunit from the purple sulfur bacterium Chromatiumvinosum (Viale et al., 1989), share only 52 and 24% identity, 14650 Sequence of Calvin Cycle Genes of R. sphaeroides respectively. A high degree of similarity has been noted between the sequence of the R. sphaeroides Rbu-Ppcarboxylase genes and sequences determined for Rbu-Ppcarboxylase from Rhodophyta and Chromophytu (Hwang and Tabita, 1991). In this case, the large subunits from a red alga and a marine diatom share approximately 70% and thesmall subunits 50% identity, respectively, with the large subunit of R. sphaeroides Rbu-Pz carboxylase. Several lines of evidence, including peptide mapping and immunological techniques (Gibson and Tabita, 1977, 1985) had previously indicated the lack of similarity between the form I and form I1 Rbu-Ppcarboxylase large subunits. Therefore, the low homology observed between the deduced sequences of the R. sphaeroides form I and form I1 Rbu-Pz carboxylase large subunits was not surprising. The two large subunits share only 25% identity at the amino acid level, the same as thatshared between the form I rbcL and theR. rubum Rbu-Pzcarboxylase large subunit (Narganget al., 1984).Many of the identical residues are clustered around sites known to be involved in the activation or catalysis of Rbu-Pz carboxylase (Fig. 6). Codon Usage-The codonusage for genes within the R. sphaeroides Calvin cycle A and B clusters is highly skewed in favor of G or C in the third position as expected for an organism containing DNA with an overall 67% G C content (Triiper and Pfennig, 1979). The pattern was virtually identical for all of the genes within the A cluster as well as for the previously published sequences of fbpB, prkB,and rbpL, from the B cluster (Wagner et al., 1988; Gibson et al., 1990). Only three codons, CCA, CTA, and TTA were never used, and six codons, all of which end in A or T, appeared only once. Of those six, ATA appeared within the amino terminus of the fbpA gene, hence its usage must be considered tentative until definitive assignment of the fbpA start codon. Insertional Mutagenesis of Genes within the Form I Cluster-The genes within the form I cluster are tightly linked. As noted previously the putative ribosome-binding site of prkA lies within the coding sequence of fbpA. Similarly, ribosome-binding sites of rbcL and rbcS are located within the small intergenic space separating those genes from cfxA and rbcL, respectively. Because of the tight spacing between coding sequences and the fact that all of the genes are oriented in the same direction, we utilized interposon mutagenesis to investigate the possibility that the five genes form part of a large operon. A trimethoprim resistance cartridge was used to disrupt fbpA and cfxA as described under “Experimental Procedures.” In preliminary experiments, the fbpA- and c f d - strains were tested for the ability to grow photosynthetically. For comparison, the wild-type strain HR,two Rbu-Ppcarboxylase deletion derivatives (rbcLrbcS- and rbpL-) (Falcone and Tabita, 1991), and an fbpB- strain (Gibson et d., 1990) were grown in parallel. All of the strainstested had similar growth rates in malate-supplemented standing cultures, and in cultures sparged with 1.5% Cop, 98.5% Hz (data not shown). Interestingly, the cfxA- strain was incapable of photoheterotrophic growth on malate when the culture was bubbled with argon until after a lag of several days, whereas the other strains exhibited growth rates comparable to the wild-type strain. The reason for this is not known, but is probably related to thedecreased concentration of COz in the medium when the culture was bubbled with argon. It should be noted that in a recent study that examined growth characteristics of cfx mutants, it was reported that even the wild-type R. sphaeroides was incapable of photoheterotrophic growth on succinate and malate without C o p (Hallenbeck et aL, 1990a). OPV DW 53 56 OW 5k PRE 43 GYL 39 I X A C I1 ff .. + I 434 437 435 425 424 X A C I1 PEILRAAAKUCK-PLEIULDTVW(ITFNVTSTDTSDfVPTASV~ PEILVEAAKUCQ-PLRRIILDWGEVTFNYASTDTSDFVPTASVA PEILRDPRRA~PLRARARYUGDITFNYTPTDTSDFVPTASVA KDVLTWIAISSP-ELKlWENKEIKFEFDNDLDlAM REURAFESFPMIDKFYPGYRDRLHRM I X A 486 187 489 469 461 PSLRnERTEVDGRSlRYTHSIVR I29 DGFRLDRTEGPGRTQRYALQHRSYRAG 133 PGFRLVRQEEPGRTLRYSIESYAVQAGPK 135 FIG. 6. Sequence comparisons of the Rbu-Pz carboxylase large and small subunits of various bacteria. Deduced amino acid sequences ofrbcL and rbcS of R. sphaeroides form I Rbu-Pz carboxylase compared with sequences from X . fluuus ( X ) (Meijer et al., 1991),A. eutrophus ( A ) (Andersen and Caton, 1987), C. uinosum (C) (Viale et al., 1989), andthe R. sphaeroides form I1Rbu-Pz carboxylase (large subunit only) (11) (Wagner et al., 1988). Identical residues are shaded. Residues implicated in activation and catalysis are shown (*) (Knight et al., 1990). We found that R. sphaeroides grows on malate or succinate in cultures bubbled with argon, albeit at a reduced rate of 7 versus 4 h in a standing culture, i.e. not bubbled with argon. The reason for this discrepancy is not clear but may reflect differences in strain orpreculture techniques. Further characterization of the mutant strains involved analysis of the various enzymes in cell extracts prepared from photoheterotrophically and photolithoautotrophically grown cells. Because R. sphueroides synthesizes two forms of these enzymes, it is impossible to assess the contribution of each isozyme to theoverall activity based on enzyme assays alone. carboxylase However, the form I and form I1 PRK and Rbu-Pp enzymes can be distinguished by immunological methods. Therefore, initialcharacterization of the fbpA- and c f d strains utilized rocket immunoelectrophoresis to detect and quantitate the antigenically distinct form I and form I1 RbuPpcarboxylase, and Western immunoblot analysis to distin- Sequence of Calvin Cycle Genes of R. sphaeroides guish between form I and form I1 PRK polypeptides which are separable by SDS-gel electrophoresis (Gibson and Tabita, 1987). Rocket immunoelectrophoresisrevealed a complete absence of form I Rbu-P2carboxylase in extracts of the fbpA-, c f d - , and rbcLrbcS- strains grown photolithoautotrophically. A corresponding increase in form I1 Rbu-P2 carboxylase was observed in these strains compared to the level present in the wild-type strain HR. The actual levels of Rbu-P2carboxylase protein as measuredby rocket immunoelectrophoresis are shown in Table I. When these extracts were examined by Western blotting and immunodetection using antiserum directed against PRK, no form I PRK could be detected in the fbpA- strain (Fig. 7). No apparent difference in the relative amounts of form I and form I1 PRK was observedin thec f d or rbcL rbcS- strain (data not shown). Similar results were reported previously for mutations within the B cluster (Gibson et al., 1990). In theseexperiments, Western blot analyses showed an absence of form I1 Rbu-P2 carboxylase and PRK in thefbpB- strain, andan absence of form I1 Rbu-Ppcarboxylase, but an unaltered PRK pattern in the rbpL- strain. In this investigation, those findings were extended by quantitatTABLE I Specific activities of Calvincycle enzymes in mutant strains R~u-P~ Rbu-P2 G~~~~ carboxylase condition protein" FBPase PRK carboxylase Strain I I1 unitsf mg protein HE'P HR 0.03 0.02 0.05 0.10 0.13 AUT 0.13 rbcLrbcSHET 0.04 0.73 0.05 0.05 0.18 0.22 AUT 3.1 0.17 0.01 0.04 rbpLHET 3.8 0.08 0.09 5.8 0.08 0.09 AUT 2.1 0.11 0.04 0.08 &AHET AUT 21.0 0.36 0.21 0.17 4.8 0.06 0.05 0.03 fWHET AUT 14.2 0.17 0.12 0.13 c f d0.17 0.03 0.02 0.05 HET 2.8 0.17 0.09 0.11 AUT a Rbu-P2 carboxylase antigen as determined by rocket immunoelectrophoresis expressed as percent total soluble protein. I, form I Rbu-Pz carboxylase; 11, form I1 Rbu-P2 carboxylase. * Photoheterotrophic growth on 0.4% malate bubbled with argon. 'Photolithoautotrophic growth on 1.5% CO2, 98.5% H2. 1 0.8 54 15 .. 96 1 2 3 4 5 6 7 8 9 FIG.7. Westernimmunoblot analysis of wild-type strain HR, and the fbpA- and fbpB- strains of R. sphaeroides. Cell extracts were prepared from photolithoautotrophically grown wildtype strain HR (lanes I , 4, and 7), the fbpA- strain (lunes 2, 5, and 81, and thefbpB- strain (lanes 3,6, and 9).Extracts were electrophoresed in SDS gels, electroblotted to nitrocellulose, and probed with antibodies raised against form I Rbu-Pzcarboxylase (lanes I-3), form I1 Rbu-P2 carboxylase (lanes 4-6), or form I PRK (lanes 7-9). 14651 ing the amount of Rbu-Pp carboxylase produced based on rocket immunoelectrophoresis. The levels of form I Rbu-Pp carboxylase increased over that observed in HR in both the fbpB- and rbpL- strains (Table I). The increase of form I Rbu-Pp carboxylase in these strains is not as dramatic, however, as that observed for the form I1 Rbu-P2 carboxylase in the strains containing mutations within the A cluster. In every case, mutations within the A and B clusters exert polar effects on downstream genes, whereas genes positioned transcriptionally upstream are still expressed. As noted previously, the simplest interpretation of these results is that the genes within each cluster form part of an operon. The increased production of the form I andform I1 Rbu-P2 carboxylase in the insertion strains observed here and in other studies (Hallenbeck et al., 1990a, 1990b) indicated that mutations within one operon could affect expression of genes within the second operon. In order to examine the effect of the mutations on expression of the various Calvin cycle enzymes more closely, the extracts were assayed for FBPase, PRK, and Rbu-P2 carboxylase activities (Table I). The derepression of Rbu-Pz carboxylase in wild-type cells grown under C02-limitingconditions is well documented (Jouanneau and Tabita, 1986; Hallenbeck et aZ., 1990a, 1990b).All of the mutants retain the C02-regulatedexpression of Rbu-P2 carboxylase as evidenced by the increase in Rbu-Pp carboxylase activity in Cop-grown cells compared to malate-grown cells. The activities of FBPase and PRK are also much higher in Cop-grown cells, suggesting the genes are subject to coordinate regulation. Unlike the wild-type, the mutants exhibit altered levels of these enzymes. For example, in the fbpAstrain, the specific activities of all three enzymes are higher than those measured in wild-type strain HR in both malateand Con-growncells. These increases are even moredramatic considering only the form I1 enzymes are presentin the fbpAstrain. In theC02-growncells, the form I1Rbu-P2carboxylase normally accounts for approximately 33% of total Rbu-P2 carboxylase (Joaunneau and Tabita, 1986). Therefore, the 2.8-fold increase in Rbu-PZ carboxylase activity in the fbpAstrain actually represents a 8.5-fold increase in the expression of form I1 Rbu-P2carboxylaseand is higher than thecombined form I and form I1 Rbu-P:! carboxylase activity in wild-type strain HR. Similar results were obtained with the fbpB- strain in which only the form I enzymes are expressed. Although the increases in activity of FBPase, PRK, and Rbu-Pz carboxylase are not as pronounced as those observed in the fbpA- strain, the levels of the form I enzymes are still substantially higher than in strainHR. The results are more difficult to interpret in the Rbu-P2 carboxylase deletion derivatives and the c f d - strain. These mutants retain bothforms of FBPase and PRK, butexpress only one form of Rbu-Pp carboxylase. The rbcLrbcS- strain basically followsthe same pattern as thefbpA- strain, except that in the fbpA- strain the Rbu-P2 carboxylase activity in C02-grown cells represents a greater increase in the amount of form I1 Rbu-P2 carboxylase compared to wild-type cells. The rbpL- strain exhibits a patternof activities distinct from the other mutant strains that in PRK and Rbu-Pp carboxylase levels are quite low in CO2-grown cells. Based on specific activity, the form I Rbu-P2 carboxylase is actually lower in this strain than in the wild-type strain. In the c f d - strain, the level of the form I1 Rbu-P2 carboxylase was higher than that observed in the wild-type strain, whereas the level of PRK was relatively unaffected. Northern Blot Analysis-Because the insertional mutagenesis studies indicated the genes within each cluster were cotranscribed, Northern hybridizations were performed to de- Sequence of Calvin Cycle Genes of R. sphaeroides 14652 termine the size of the transcripts. In all cases, the probes hybridized mainlyto transcriptscapable of encoding only one or two genes.The predominant transcripts that hybridized to the rbcL probe were 2.0 and 1.5 kb, whereas an rbpL probe hybridized to a single transcript of 1.5 kb (Fig. 8a). In both cases, the size of the transcriptis just large enough to contain the Rbu-P, carboxylase coding sequences. No rbcLrbcS transcript was detected in the fbpA- strain andno rbpL transcript was detected in the fbpB- strain, even when autoradiograms were overexposed (Fig. 8b). The gapB probe revealed a predominant transcript of approximately 1.0 kb that was completely absent in the fbpB- strain (Fig. 8b). As noted for the Rbu-P, carboxylase transcripts, this message is capable of encoding gapB alone. The c f d probe hybridized primarily to a transcript of 1.7 kb, although longer transcripts are visible (Fig. 8b). The cfx probe hybridizes to both c f d and cfxB which accounts for the hybridization observed in the fbpAandfbpB- backgrounds. The probes for fbp andprk hybridized to transcripts of 2.0 kb or less (data not shown). In some experiments, all of the probes hybridized to a much larger transcript. This can be clearly seen with RNA from wild-type strain HR probed with cfxA (Fig. 8b). This may represent an unstable primary product of transcription from which the smaller transcripts are derived as a result of posttranscriptional processing. The lack of detectable transcript for rbcL and fbpA- strain and for rbpL in the fbpB- strain is consistent with the absence of Rbu-Pp carboxylase protein observed in Western immunoblots (Fig. 7). Similar results were recently described with cfx and prk mutants, although in this study small amounts of a rbcl rbpl 2.01.5- -1.5 i r 1 2 b rbcL rbpL FIG.8. Northern hybridization of RNA from R. sphaeroides. A , total RNA isolated from the wild-type strain HR grown photolithoautotrophically was fractionated in a 1%agarose-formaldehyde gel, blotted to nitrocellulose, and probed with nick-translated DNA fragments specific for rbcL (lane I ) or rbpL (lune 2 ) . B, total RNA isolatedfrom photolithoautotrophically grown cells of the fbpAstrain ( A - ) ,wild-type strain ( H R ) ,or thefbpB- strain (B-).The blots were probedwith nick-translated DNA fragments. Eachpanel is designated by the gene corresponding to the DNA fragment used as a probe. The blots in B are overexposed to illustrate the lack of detectable rbcL transcript in the fbpA- strain and the lack of rbpL and gupB transcripts in the fbpB- strain. Burs on the right denote the migration of X-Hind111 digest fragments corresponding, from the top, to 4.4, 2.3, 2.0, and 0.6 kb. transcript were observedin Northern blots in strains containing insertions upstream from rbpL (Hallenbeck et al., 1990a, 1990b). DISCUSSION Determination of the nucleotide sequence of the region encompassing the form I Copfixation gene cluster revealed a very tight linkage of the five genes. In addition, the coding sequences were oriented in the same direction suggesting the genes might comprise at least part of a single transcriptional unit. The possibility of co-transcription was substantiated by results obtained from directed interposon mutagenesis of genes within the form I cluster, as insertions were found to exert polar effects on expression of downstream genes. As part of an operon, genes encoding enzymes of a tightly regulated pathway such as the Calvin cycle would acquire the potential for coordinate regulation and expression. Because of the polarity of the insertions, strains containing mutations within either fbpA or fbpB conveniently provided backgrounds of only one form of Rbu-P2 carboxylase and PRK which were then easily quantitated by enzyme assay. Using the fbpA- and fbpB- strains, it was clearlydemonstrated that in addition to Rbu-Pp carboxylase, PRK is derepressed under conditions of CO, limitation, demonstrating the coordinate induction of at least twoenzymesin each cluster. Although FBPase activity was also measured in these strains and followed basicallythe same pattern of induction as PRK and Rbu-P, carboxylase, these results are tempered by the potential presence of a third “heterotrophic” FBPase. In any case, the levels of gene products observed under different growth conditions are reflective of a coordinated synthesis. In R. sphueroides grown under derepressing conditions, Rbu-Pa carboxylase is generally present at much higher levels than PRK, such that Rbu-Pp carboxylase approaches 12% of the soluble protein. Therefore, if the genes of the form I cluster are co-transcribed, there must also exist post-transcriptional control mechanisms to account for the high level of Rbu-Pp carboxylase relative to other enzymes encoded by genes in the operon. A myriad of possibilities exist as to how differential expression of genes transcribed as apolycistronic unit might be accomplished. One mechanism that is consistent with the results obtained in the analysis of transcripts from the form I Con fixation cluster involves differential stability of segments of transcripts within a polycistronic message (Belasco and Higgins, 1988). This type of regulation most commonly involves preferential decay of the 3‘ end of the message, thereby resulting in increased expression of the 5’-translation products (Belasco and Higgins, 1988). However, in the R. sphueroides CO, fixation clusters, the more highly expressed Rbu-P, carboxylase genes are 3’ to genes encoding the less abundant PRK. One situation has been documented in which the 3‘ gene product is the most abundant protein produced from an operon (Blga et al., 1988). In the E. coli pilin operon the 5’ segment of the transcript is degradedmore rapidly thanthe 3’ end followingspecific endonucleolyticcleavage. In theR. sphueroides form I cluster, post-transcriptional endonucleolytic cleavagecould explain the small discrete transcripts of genes of the form I cluster that were revealedby Northern hybridizations. This possibility is currently under investigation as well as turnover of the various messages as potential control mechanisms of COn fixation in this organism. The form I1 Calvin cycle cluster in R. sphueroides is similar in gene organization to the form I cluster with respect to the 3‘ positioning of the Rbu-Pp carboxylase coding sequence. Therefore, similar control mechanisms could be involved in Sequence of Calvin Cycle Genes of R. sphaeroides post-transcriptional regulation of the form Iand form I1 operons. In this context, it is interesting to note that the spatial arrangement of genes within other bacterial COPfixation clusters differs from that found in R. sphueroides. In A. eutrophus, a facultative chemolithoautotrophic bacterium, the genes encoding several Calvin cycle enzymes are duplicated and clustered within two very similar operons (Windhovel and Bowien, 1990). As in R. sphaeroides, the FBPase and PRK coding sequences are tandemly arrangedinatight linkage. However, these genes are situated downstream from the Rbu-Pz carboxylase coding sequences. The COP fixation genes in X . f l a w u s have also been mapped within a single cluster (Meijer et al., 1990). In this organism, the gene arrangement is similar, although not identical to that of A. eutrophus. Although the functional significance of the different arrangements of genes within the COz fixation clusters is not known, gene order may turn out to play a crucial role in regulation of gene expression in these systems. Several lines of evidence suggest the genes within the form I and form I1 Calvin cycle clusters constitute two operons. In this regard, the tentativeidentification of the cfxA gene product asaldolase, on the basis of sequence comparisons, was not surprising in view of its position amidst other structuralgenes of the same pathway. Although the degree of similarity of cfxA to theE. coli fba is not high, the relatedness does extend over the full length of both reading frames. Moreover, the high degree of identity observed between the amino terminus of the B. stearothermophilus aldolase and the R. sphaeroides cfxA gene product suggests these sequences maybemore closely related than are theE. coli fba and R. sphaeroides cfxA products. Alternatively, the low homology may represent a photosynthetic aldolase specifically adapted in functional and regulatory characteristics to the needs of the Calvin cycle in R. sphaeroides. Finally, the linkage of fba to gap in E. coli further strengthens the possibility that cfx is aldolase. Although cfxA is not linked to gap in the form I cluster, its homolog, cfxB, is situated immediately downstream of gapB in the form I1 cluster. In previous studies, cfxA andprkA mutantsexhibited drastically decreased growth rates duringCOP-limitedgrowth compared to thewild-type strain (Hallenbeck et al.,1990a, 1990b). The differences in growth were attributed to the absence of form I Rbu-Pz carboxylase, the rationale being that the high affinity of form I Rbu-PPcarboxylase for COPmakes it essential for COP limited growth. However, in this study, the rbcLrbcS- strain exhibited wild-type growth rates under malate-argon growth conditions. In addition, a requirement of form I Rbu-PP carboxylase for COP-limited growth cannot explain the wild-type growth characteristics of the fbpAstrain. One possible explanation of these seemingly discrepant observations may lie in theidentity of cfx as aldolase. FBPase and aldolase catalyze diametrically opposed reactions in the Calvin cycle, the former being responsible for the breakdown of FBP and sedoheptulose 1,7-bisphosphate, the latter for their synthesis. In the fbpA- and rbcLrbcS- mutants, the balance of FBPase and aldolase is maintained,whereas in the prk and cfx mutants there aretwo copies of “photosynthetic” 14653 FBPase to one copy of the putative aldolase. Disruption of the relative amounts of these two antagonistic enzymes may lead to futile cycling of metabolites. Acknowledgment-We are grateful to Sandy Smith of the Amino Acid Sequencing Facility of the University of Texas at Austin. REFERENCES Alefounder, P. R., and Perham, R. N. (1989) Mol. Microbiol. 3 , 723732 Alefounder, P. R., Baldwin, S. A., Perham, R. N., and Short, N. J. (1989) Biochem. J. 257,529-534 Andersen, K., and Caton, J. (1987) J. Bacteriol. 169,4547-4558 BHga, M., Goransson, M., Normark, S., and Uhlin, B. E. (1988) Cell 52,197-206 Belasco, J. G., and Higgins, C. F. (1988) Gene (Amst.) 7 2 , 15-23 Falcone, D. L., and Tabita,F. R. (1991) J. Bacteriol. 173,2099-2108 Falcone, D. L., Quivey, R. G.,Jr., and Tabita,F. R. (1988) J. Bacteriol. 170,5-11 Gibson, J. L., and Tabita, F. R. (1977) J. Biol. Chern. 252,943-949 Gibson, J . L., and Tabita, F.R. (1985) J. Bacteriol. 1 6 4 , 11W-1193 Gibson, J. L., and Tabita, F. R. (1986) Gene (Amst.) 4 4 , 271-278 Gibson, J . L., and Tabita, F. R. (1987) J. Bacteriol. 169,3685-3690 Gibson, J. L., and Tabita, F. R. (1988) J. Bacteriol. 170, 2153-2158 Gibson, J . L., Chen, J.-H., Tower, P. A., and Tabita, F. R. (1990) Biochemistry 29,8085-8093 Hallenbeck, P. L., and Kaplan, S. (1987) J. Bacteriol. 1 6 9 , 36693678 Hallenbeck, P. L., Lerchen, R., Hessler, P., and Kaplan, S. (1990a) J. Bacteriol. 1 7 2 , 1736-1748 Hallenbeck, P. L., Lerchen, R., Hessler, P., and Kaplan, S. (1990b) J. Bacteriol. 172, 1749-1761 Hwang, S.-R., and Tabita, F. R. (1991) J. Biol. Chern. 266, 62716279 Jouanneau, Y., and Tabita, F. R. (1986) J. Bacteriol. 165,620-624 Kay, R., and McPherson, J. (1987) Nucleic Acids Res. 1 5 , 2778 Knight, S., Anderssen, I., and Branden, C.-I. (1990) J. Mol. Biol. 2 1 5 , 113-160 Markwell, M. A., Haas, S. M., Bieber, L. L., and Tolbert, N. E. (1978) Anal. Biochem. 87,206-210 Meijer, W. G., Enequist,H. G., Terpstra, P., and Dijkhuizen, L. (1990) J. Gen. Microbiol. 1 3 6 , 2225-2230 Meijer, W. G., Arnberg, A. C., Enequist, H. G., Terpstra, P., Lidstrom, M. E., and Dijkhuizen, L. (1991) Mol. Gen. Genet. 225,320-330 Nargang, F., McIntosh, L., and Sommerville, C. (1984) Mol. Gen. Genet. 193,220-224 Quivey, R. G., Jr., and Tabita,F.R. (1984) Gene (Amst.) 3 1 , 91-101 Sanger, F., Nicklen, S., and Coulson, A. R. (1977) Proc. Natl. Acad. Sci. U. S. A. 74,5463-5467 Simon, R., Priefer, V., and Puhler, A. (1983) Bioltechnology 1 , 784791 Tabita, F. R. (1980) J. Bacteriol. 1 4 3 , 1275-1280 Tabita, F. R., Gibson, J. L., Mandy, W. J., and Quivey, R. G., Jr. (1986) BiolTechnology 4, 138-141 Triiper, H. G., and Pfennig, N. (1979) in The Photosynthetic Bacteria (Clayton, R.K., and Sistrom, W.R., eds) pp. 19-27, Plenum Publishing Corp., New York Viale, A. M., Kobayashi, H., and Akazawa, T. (1989) J. Bacteriol. 171,2391-2400 Wagner, S. J., Stevens, S. E., Jr., Nixon, B. T., Lambert, D. H., Quivey, R. G., Jr., and Tabita, F. R. (1988) FEMS Microbiol. Lett. 55,217-222 Weaver, K. E., and Tabita, F. R. (1983) J. Bacteriol. 1 6 5 , 507-515 Windhovel, U., and Bowien, B. (1990) Arch. Microbiol. 154,85-91 Yanisch-Perron, C., Vieira, J., and Messing, J . (1985) Gene (Amst.) 33,103-119 Zhu, Y. S., and Kaplan, S. (1985) J . Bacteriol. 162,925-932

Helpful hints for preparing your ‘Sample Filled Up Bir Form Ot’ digitally

Are you fed up with the inconvenience of managing paperwork? Look no further than airSlate SignNow, the ultimate electronic signature tool for individuals and small to medium-sized businesses. Bid farewell to the monotonous task of printing and scanning documents. With airSlate SignNow, you can effortlessly finish and sign paperwork online. Utilize the extensive features built into this intuitive and cost-effective platform and transform your method of document management. Whether you need to approve forms or gather signatures, airSlate SignNow manages everything seamlessly, with just a few clicks.

Follow this comprehensive guide:

  1. Sign in to your account or sign up for a complimentary trial of our service.
  2. Click +Create to upload a file from your device, cloud storage, or our template library.
  3. Edit your ‘Sample Filled Up Bir Form Ot’ in the editor.
  4. Click Me (Fill Out Now) to finalize the document on your end.
  5. Add and designate fillable fields for others (if necessary).
  6. Continue with the Send Invite settings to request eSignatures from others.
  7. Save, print your copy, or convert it into a multi-use template.

Don’t be concerned if you need to collaborate with your colleagues on your Sample Filled Up Bir Form Ot or send it for notarization—our solution provides everything you need to complete such tasks. Create an account with airSlate SignNow today and take your document management to a higher level!

Here is a list of the most common customer questions. If you can’t find an answer to your question, please don’t hesitate to reach out to us.

Need help? Contact Support
Sign up and try Sample filled up bir form ot
  • Close deals faster
  • Improve productivity
  • Delight customers
  • Increase revenue
  • Save time & money
  • Reduce payment cycles